Web Analysis for Elitemarketingpro Seanlynnwyman - seanlynnwyman.elitemarketingpro.com
Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs
This website is a sub-domain of elitemarketingpro.com. It has a global traffic rank of #92015 in the world. This website is estimated worth of $ 90,000.00 and have a daily income of around $ 125.00. As no active threats were reported recently by users, seanlynnwyman.elitemarketingpro.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
No Risk Issues
Traffic Report
| Daily Unique Visitors: | 10,457 |
| Daily Pageviews: | 62,742 |
Estimated Valuation
| Income Per Day: | $ 125.00 |
| Estimated Worth: | $ 90,000.00 |
Search Engine Indexes
| Google Indexed Pages: | Not Applicable |
| Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
| Google Backlinks: | Not Applicable |
| Bing Backlinks: | Not Applicable |
Safety Information
| Google Safe Browsing: | No Risk Issues |
| Siteadvisor Rating: | No Risk Issues |
| WOT Trustworthiness: | Not Applicable |
| WOT Child Safety: | Not Applicable |
Website Ranks & Scores
| Alexa Rank: | 92,015 |
| Domain Authority: | Not Applicable |
Web Server Information
Hosted IP Address:
45.33.23.182
Hosted Country:
US
Location Latitude:
32.7787Location Longitude:
-96.8217Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
| H1 Headings: | Not Applicable | H2 Headings: | 2 |
| H3 Headings: | 1 | H4 Headings: | 2 |
| H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
| Total IFRAMEs: | 1 | Total Images: | 10 |
| Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 45.33.23.182)
Elite Marketing Pro | Welcome
Elite Marketing Pro is a global community of over 50,000 active small business entrepreneurs, providing targeted education, training, and mentoring programs
96,429
$
86,400.00
HTTP Header Analysis
Date: Sat, 20 May 2017 22:57:41 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Access-Control-Allow-Origin: *
P3P: CP="NOI"
Expires: Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Pragma: no-cache
Link: <http://elitemarketingpro.com/wp-json/>; rel="https://api.w.org/", <http://elitemarketingpro.com/>; rel=shortlink
Vary: Accept-Encoding
Last-Modified: Sat, 20 May 2017 22:57:41 GMT
Server: cloudflare-nginx
CF-RAY: 3622e57222045ea6-TPA
Content-Encoding: gzip
DNS Record Analysis
| Host | Type | TTL | Extra |
|---|---|---|---|
| seanlynnwyman.elitemarketingpro.com | A | 286 |
IP: 45.33.23.182 |
Similarly Ranked Websites
Косметика Vichy. Официальный сайт на русском языке и интернет магазин
Официальный интернет магазин Vichy (Виши) в России предлагает аптечную косметику по уходу за кожей и волосами. Широкий ассортимент, рекомендации по уходу за кожей, онлайн-диагностика на сайте.
92,017
$
158,400.00
Games for Girls - AgnesGames.com
Play free online girl games at AgnesGames.com
92,017
$
158,400.00
A Link Directory
Submit your web site free for review and inclusion to our fast growing free link directory.
92,017
$
158,400.00
Taconeras - La red de blogs femeninos
Taconeras es la red de blogs del sexo femenino, compuesta por las comunidades de siete revistas de la Editorial Televisa.
92,020
$
90,000.00
